Crucial Role of Position 40 for Interactions of Cck-58 Revealed by Sequence of Cat Cck-58.
From: CURE: Digestive Diseases Research Center, Veterans Administration Greater Los Angeles Healthcare System, Los Angeles, CA 90073, USA.
Biochemical and biophysical research communications
- Publish Date: Sep 2006
- ISSN: 0006-291X
- Volume: 348
- Issue: 3
- Pages: 819-25
- Medium: Print
- Language: English
- Citation (JAMA): Reeve Joseph R, Rosenquist Grace L, Keire David A, et al. Crucial Role of Position 40 for Interactions of Cck-58 Revealed by Sequence of Cat Cck-58.. Biochem. Biophys. Res. Commun. Sep 2006;348:819-25
Abstract
Evidence suggests that amino terminal extensions of CCK-8 affect the carboxyl terminal bioactive region of CCK. Cat CCK-58 was purified by low pressure reverse phase and ion-exchange chromatography steps and several reverse phase HPLC steps. The purified peptide and its tryptic fragments were characterized by mass spectral analysis and microsequence analysis. The structure of cat CCK-58 is: AVQKVDGEPRAHLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDY(SO3) MGWMDF-amide. Cat and dog CCK-58 are identical except for position 40 which is serine in cat and asparagine in dog. Radioimmunoassay detected cat CCK-58 about 1/10th as well as dog CCK-58, indicating a marked effect on C-terminal immunoreactivity. Cat CCK-58 with a serine at position 40, the same residue found in pig, mouse, cow and rabbit CCK-58, can be used as a unique bioprobe for defining how amino terminal amino acids influence the structure and bioactivity of the carboxyl terminal region of CCK.
Mesh Headings (Keywords): Amino Acid Sequence, Animals, Cats, Cholecystokinin, Dogs, Male, Molecular Sequence Data, Protein Interaction Mapping, Protein Structure, Tertiary, Sequence Analysis, Protein, Serine
Check for Full Text / PubMed Unique Identifier (PMID): 16904071
This abstract is part of PubMed, a service of the U.S. National Library of Medicine. PubMed includes more than 17 million citations from MEDLINE and other life science journals for biomedical articles. See Copyright and Disclaimers.
Linked medical terms appearing on this page are added by Healia to help readers find more information and are not part of the original PubMed document.
The data herein was last updated on July 8th, 2008 and may not reflect the most current and accurate data available from NLM.
